518-831-8000 sales@utechproducts.com

AGXT, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant AGXT, Each

1,148.40

Details

This gene is expressed only in the liver and the encoded protein is localized mostly in the peroxisomes, where it is involved in glyoxylate detoxification. Mutations in this gene, some of which alter subcellular targetting, have been associated with type I primary hyperoxaluria. [provided by RefSeqSequence: HPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGS

Additional Information

SKU 10288874
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22869