518-831-8000 sales@utechproducts.com

AGXT2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant AGXT2, Each

1,203.84

Details

The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor. [provided by RefSeqSequence: DVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK

Additional Information

SKU 10289066
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23103