AIG1 Recombinant Protein, Human AIG1 full-length ORF recombinant protein with GST-tag at N-terminal, Each

$ 1,129.55
|
Details
Theoretical MW (kDa): 51.92Preparation method: In vitro wheat germ expression systemPurification: Glutathione Sepharose 4 fast flowStorage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution bufferSequence: MALVPCQALRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQERERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQHPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQKSMEEEKEKPKLEBest use within three months from the date of receipt of this protein.ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Additional Information
SKU | 1265371 |
---|---|
UOM | Each |
UNSPSC | 12352200 |
Manufacturer Part Number | H00051390P0125 |
Schedule B Number | 3002.10.0220 |