ANKRD2 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ANKRD2, Each

$ 1,203.84
|
Details
ANKRD2 belongs to the conserved muscle ankyrin repeat protein (MARP) family. Expression of MARPs is induced in response to physiologic stress, injury, and hypertrophy (Miller et al., 2003 [PubMed 14583192]).[supplied by OMIMSequence: IIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ
Additional Information
SKU | 10291931 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB27887 |