apolipoprotein C-IV, Rabbit, Purified MaxPab Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against a full-length human APOC4 protein, Each

Details

Apolipoprotein (apo)C4 gene is a member of the apolipoprotein gene family. It is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family. Apo C4 is a 3.3kb gene consisting of 3 exons and 2 introns; it is located 0.5kb 5' to the APOC2 gene. [provided by RefSeqSequence: MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG