518-831-8000 sales@utechproducts.com

ARHGEF10L Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ARHGEF10L, Each

1,203.84

Details

ARHGEF10L is a member of the RhoGEF family of guanine nucleotide exchange factors (GEFs) that activate Rho GTPases (Winkler et al., 2005 [PubMed 16112081]).[supplied by OMIMSequence: LLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQAQNKVYL

Additional Information

SKU 10288228
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22108