ASGR1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ASGR1, Each

Details

Partially deglycosylated plasma glycoproteins and immunoglobulin IgA2 allotypes are efficiently and specifically removed from circulation by a receptor-mediated process. The asialoglycoprotein receptor binds to desialylated (galactosyl-terminal) glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociate. Then the receptor is recycled back to the cell surface and the ligand is transported to the lysosomes for degradation. [provided by RefSeqSequence: MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRL