518-831-8000 sales@utechproducts.com

B4GALNT2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant B4GALNT2, Each

1,148.40

Details

B4GALNT2 catalyzes the last step in the biosynthesis of the human Sd(a) antigen through the addition of an N-acetylgalactosamine residue via a beta-1,4 linkage to a subterminal galactose residue substituted with an alpha-2,3-linked sialic acid. B4GALNT2 also catalyzes the last step in the biosynthesis of the Cad antigen (Montiel et al., 2003 [PubMed 12678917]).[supplied by OMIMSequence: LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA

Additional Information

SKU 10287117
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20841