518-831-8000 sales@utechproducts.com

BCL7A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant BCL7A, Each

1,148.40

Details:

This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: QADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSE

Additional Information

SKU 10292014
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28020