518-831-8000 sales@utechproducts.com

BRD1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant BRD1, Each

1,199.28

Details

This gene encodes a protein of unknown function. The protein contains a bromodomain, a sequence motif often found in transcriptional coactivators, and localizes to the nucleus in testis and several other cell types. [provided by RefSeqSequence: IAAEVGQSSMWISTDAAASVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGEPTSD

Additional Information

SKU 10286403
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20028