C17orf39, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C17orf39, Each
$ 1,148.40
|
|
Details:
The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeqSequence: DTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYE
Additional Information
| SKU | 10290005 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24319 |
Loading Cart Data 