518-831-8000 sales@utechproducts.com

C17orf70 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C17orf70, Each

1,203.84

Details

FAAP100 is a component of the Fanconi anemia (FA; MIM 277650) core complex and is required for core complex stability and FANCD2 (see MIM 227646) monoubiquitination (Ling et al., 2007 [PubMed 17396147]).[supplied by OMIMSequence: VPLCCATLQWLLAENAAVDVVRARALSSIQGVAPDGANVHLIVREVAMTDLCPAGPIQAVEIQVESSSLA

Additional Information

SKU 10287810
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21630