C2orf56, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C2orf56, Each

$ 1,148.40
|
Details
The function of this gene is not known, however, its existence is supported by mRNAs and EST data. Transcript variants encoding different isoforms have been noted for this gene.Sequence: ISVHLVEVSQKLSEIQALTLTKEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLPVHKFQKTPQGWREVFVDIDPQVSD
Additional Information
SKU | 10290076 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB24396 |