C2orf56, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C2orf56, Each
$ 1,148.40
|
|
Details:
The function of this gene is not known, however, its existence is supported by mRNAs and EST data. Transcript variants encoding different isoforms have been noted for this gene.Sequence: ISVHLVEVSQKLSEIQALTLTKEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLPVHKFQKTPQGWREVFVDIDPQVSD
Additional Information
| SKU | 10290076 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24396 |
Loading Cart Data 