CC2D2A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CC2D2A, Each

$ 1,203.84
|
Details
This gene encodes a coiled-coil and calcium binding domain protein that appears to play a critical role in cilia formation. Mutations in this gene cause Meckel syndrome type 6, as well as Joubert syndrome type 9. Alternative splicing results in multiple transcript variants. [provided by RefSeqSequence: SVTPNDQCPRAEVSRREDVKKRSVYLKVLFNNKEVSRTVSRPLGADFRVHFGQIFNLQIVNWPESLTLQVYETVGHSSPTLLAEVFLPIPETTVVTGRAPTEEVEFSSN
Additional Information
SKU | 10289987 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB24295 |