518-831-8000 sales@utechproducts.com

CENPE, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CENPE, Each

1,148.40

Details

Centrosome-associated protein E is a kinesin-like motor protein that accumulates in the G2 phase of the cell cycle. Unlike other centrosome-associated proteins, it is not present during interphase and first appears at the centromere region of chromosomes during prometaphase. CENPE is proposed to be one of the motors responsible for mammalian chromosome movement and/or spindle elongation. [provided by RefSeqSequence: EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN

Additional Information

SKU 10289799
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23920