CHCHD4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CHCHD4, Each
$ 1,203.84
|
|
Details
CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIMSequence: ELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDL
Additional Information
| SKU | 10288826 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22814 |
Loading Cart Data 