CLK3 (M07A), Mouse anti-Human, Clone: 7D6, Abnova, Mouse monoclonal antibody raised against a partial recombinant CLK3, Each
Call For Price
Details:
This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Two transcript variants encoding different isoforms have been found for this gene. Related pseudogenes are located on chromosomes 1 and 9. [provided by RefSeqSequence:Â YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV
Additional Information
| SKU | 10006435 |
|---|---|
| UOM | Each |
| UNSPSC | 12352200 |
| Manufacturer Part Number | H00001198M07A |
