CLRN2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CLRN2, Each
$ 1,148.40
|
|
Details:
This gene belongs to the clarin family of genes. The clarins appear to belong to a large superfamily of small integral membrane glycoproteins with four transmembrane domains. The exact function of this gene is unknown. [provided by RefSeqSequence: VKFHDLTERIANFQEKLFQFVVVEEQYEES
Additional Information
| SKU | 10289814 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23939 |
Loading Cart Data 