CLRN2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CLRN2, Each

$ 1,203.84
|
Details
This gene belongs to the clarin family of genes. The clarins appear to belong to a large superfamily of small integral membrane glycoproteins with four transmembrane domains. The exact function of this gene is unknown. [provided by RefSeqSequence: VKFHDLTERIANFQEKLFQFVVVEEQYEES
Additional Information
SKU | 10289814 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB23939 |