518-831-8000 sales@utechproducts.com

CLRN2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CLRN2, Each

1,148.40

Details

This gene belongs to the clarin family of genes. The clarins appear to belong to a large superfamily of small integral membrane glycoproteins with four transmembrane domains. The exact function of this gene is unknown. [provided by RefSeqSequence: VKFHDLTERIANFQEKLFQFVVVEEQYEES

Additional Information

SKU 10289814
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23939