518-831-8000 sales@utechproducts.com

CNTN6, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CNTN6, Each

1,203.84

Details

The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. [provided by RefSeqSequence: TQEPHDVIFPLDLSKSEVILNCAANGYPSPHYRWKQNGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQF

Additional Information

SKU 10287162
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20895