COL22A1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant COL22A1, Each
$ 1,148.40
|
|
Details
COL22A1, a member of the FACIT (fibrillar-associated collagens with interrupted triple helices) subgroup of the collagen protein family, specifically localizes to tissue junctions (Koch et al., 2004 [PubMed 15016833]).[supplied by OMIMSequence: LKEELEEIASEPKSAHVFHVSDFNAIDKIRGKLRRRLCENVLCPSVRVEGDRFKHTNGGTKEITGFDLMDLFSVKEILGKRENGAQSSYVRMG
Additional Information
| SKU | 10287921 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21752 |
Loading Cart Data 