Colec11, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Colec11, Each
$ 1,757.70
|
|
Details:
COLEC11 is a member of the collectin family of C-type lectins, which contain a collagen-like domain and a carbohydrate recognition domain, and play a role in host-defense (Keshi et al., 2006 [PubMed 17179669]).[supplied by OMIMSequence: INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Additional Information
| SKU | 10288747 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22718 |
