COLEC11, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant COLEC11, Each

$ 1,203.84
|
Details
COLEC11 is a member of the collectin family of C-type lectins, which contain a collagen-like domain and a carbohydrate recognition domain, and play a role in host-defense (Keshi et al., 2006 [PubMed 17179669]).[supplied by OMIMSequence: INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Additional Information
SKU | 10288747 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB22718 |