DCLRE1A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DCLRE1A, Each
$ 1,148.40
|
|
Details:
DNA interstrand cross-links prevent strand separation, thereby physically blocking transcription, replication, and segregation of DNA. DCLRE1A is one of several evolutionarily conserved genes involved in repair of interstrand cross-links (Dronkert et al., 2000 [PubMed 10848582]).[supplied by OMIMSequence: TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQSRAG
Additional Information
| SKU | 10289050 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23083 |
Loading Cart Data 