DCTN5, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DCTN5, Each

Details:

Dynactin (see MIM 601143) is a multimeric protein essential for minus-end-directed transport driven by the microtubule-based motor dynein (see DYNC1H1; MIM 600112). DCTN5 is a subunit of the pointed-end subcomplex of dynactin that is thought to interact with membranous cargo (Parisi et al., 2004 [PubMed 15043994]).[supplied by OMIMSequence: LGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGV