518-831-8000 sales@utechproducts.com

DHX40, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DHX40, Each

1,148.40

Details

DDX40 is a member of the DExH/D box family of ATP-dependent RNA helicases. RNA helicases catalyze the unwinding of double-stranded RNA and play a role in RNA metabolism, including pre-mRNA splicing, ribosome biogenesis, and organellar gene expression.[supplied by OMIMSequence: SVGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHEFNAHDLSSVARREVREDARRRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARF

Additional Information

SKU 10290006
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24320