DNAAF2 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DNAAF2, Each
$ 1,757.70
|
|
Details:
The KTU gene encodes a protein conserved in animals and ciliated unicellular organisms involved in preassembly of dynein arm complexes in species from algae to humans (Omran et al., 2008 [PubMed 19052621]).[supplied by OMIMSequence: LQGKEERVNEESHLTEKEYIEHCNTPTTDSDSSIAVKALQIDSFGLVTCFQQESLDVSQMILGKSQQPESKMQSEFIKEKSATCSNEEKGNLNESVITEEKETDGDHLSSLLNKTTVHNIPGFDSIKETNMQDGSVQVIK
Additional Information
| SKU | 10286503 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20137 |
