518-831-8000 sales@utechproducts.com

Dnaaf2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dnaaf2, Each

1,757.70

Details:

The KTU gene encodes a protein conserved in animals and ciliated unicellular organisms involved in preassembly of dynein arm complexes in species from algae to humans (Omran et al., 2008 [PubMed 19052621]).[supplied by OMIMSequence: GEPLCPPLLCNQDKETLTLLIQVPRIQPQSLQGDLNPLWYKLRFSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLE

Additional Information

SKU 10286619
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20263