DNAJC25-GNG10, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DNAJC25-GNG10, Each

$ 1,203.84
|
Details
This gene represents naturally-occurring mRNAs that are co-transcribed products of the neighboring DNAJC25 and GNG10 genes. These transcripts include the first exon of DNAJC25 and the last two exons of GNG10, resulting in a protein that combines the N-terminus of DNAJC25 and the C-terminus of GNG10. [provided by RefSeqSequence: NIKGKEYGEEERLYIIRKSMKMSKSQFDSLEDHQKETFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD
Additional Information
SKU | 10291700 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB27473 |