518-831-8000 sales@utechproducts.com

DPH3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DPH3, Each

1,203.84

Details

This gene encodes a CSL zinc finger-containing protein that is required for dipthamide biosynthesis. The encoded protein is necessary for the initial step in the modification of a histidine residue in elongation factor-2 to diphthamide. This modified residue is a target for ADP ribosylation by the bacterial toxins diphtheria toxin and Pseudomonas exotoxin A. Alternative splicing results in multiple transcript variants that encode the same isoform. [provided by RefSeqSequence: EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK

Additional Information

SKU 10288711
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22674