DRG2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DRG2, Each

$ 1,203.84
|
Details
The DRG2 gene encodes the developmentally regulated GTP-binding protein 2, a name derived from the fact that it shares significant similarity to known GTP-binding proteins. DRG2 was identified because it is expressed in normal fibroblasts but not in SV40-transformed fibroblasts. Read-through transcripts containing this gene and a downstream gene have been identified, but they are not thought to encode a fusion protein. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeqSequence: YKIFNAEVLFREDCSPDEFIDVIVGNRVYMPCLYVYNKIDQISMEEVDRLARKPNSVVISCGMKLNLDYLLEMLWEYLALTCIYTKKRGQRPDFTDAIILRKGASVEHVCHRIHRSLASQFKYALVWGTSTKYSPQRVGLTHTMEHEDVI
Additional Information
SKU | 10286725 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB20391 |