518-831-8000 sales@utechproducts.com

DSCR3 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DSCR3, Each

1,203.84

Details

The region of chromosome 21 between genes CBR and ERG (CBR-ERG region), which spans 2.5Mb on 21q22.2, has been defined by analysis of patients with partial trisomy 21. It contributes significantly to the pathogenesis of many characteristics of Down syndrome, including morphological features, hypotonia, and mental retardation. The DSCR3 (Down syndrome critical region gene 3) gene is found in this region and is predictated to contain eight exons. DSCR3 is expressed in most tissues examined. [provided by RefSeqSequence: GKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGKFTPSPV

Additional Information

SKU 10287738
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21553