DSCR4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DSCR4, Each
$ 1,148.40
|
|
Details
The region of chromosome 21 between genes CBR and ERG (CBR-ERG region), which spans 2.5Mb on 21q22.2, has been defined by analysis of patients with partial trisomy 21. It contributes significantly to the pathogenesis of many characteristics of Down syndrome, including morphological features, hypotonia, and mental retardation. This gene is found in this region and multiple transcripts may exist. It is mainly expressed in the placenta. [provided by RefSeqSequence: MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGR
Additional Information
| SKU | 10287399 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21167 |
