518-831-8000 sales@utechproducts.com

EBP, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant EBP, Each

1,148.40

Details

The protein encoded by this gene is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2 antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. This protein shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved in the transport of cationic amphiphilics. Another prominent feature of this protein is its high content of aromatic amino acid residues (>23%) in its transmembrane segments. These aromatic amino acid residues have been suggested to be involved in the drug transport by the P-glycoprotein. Mutations in this gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome). [provided by RefSeqSequence: YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF

Additional Information

SKU 10286531
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20167