EIF1AY, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant EIF1AY, Each
$ 1,203.84
|
|
Details
This gene encodes a protein similar to eukaryotic translation initiation factor 1A (EIF1A). EIF1A is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeqSequence: KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQ
Additional Information
| SKU | 10292435 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28590 |
Loading Cart Data 