518-831-8000 sales@utechproducts.com

EIF1AY, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant EIF1AY, Each

1,148.40

Details:

This gene encodes a protein similar to eukaryotic translation initiation factor 1A (EIF1A). EIF1A is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeqSequence: KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQ

Additional Information

SKU 10292435
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28590