518-831-8000 sales@utechproducts.com

ERGIC1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ERGIC1, Each

1,148.40

Details

This gene encodes a cycling membrane protein which is an endoplasmic reticulum-golgi intermediate compartment (ERGIC) protein which interacts with other members of this protein family to increase their turnover. [provided by RefSeqSequence: VVNELYVDDPDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINK

Additional Information

SKU 10287403
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21171