518-831-8000 sales@utechproducts.com

ETFDH, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ETFDH, Each

1,148.40

Details

Electron-transferring-flavoprotein dehydrogenase in the inner mitochondrial membrane accepts electrons from electron-transfer flavoprotein which is located in the mitochondrial matrix and reduces ubiquinone in the mitochondrial membrane. The protein is synthesized as a 67kDa precursor which is targeted to mitochondria and processed in a single step to a 64kDa mature form located in the mitochondrial membrane. Deficiency in electron-transferring-flavoprotein dehydrogenase have been demonstrated in some patients with type II glutaricacidemia. [provided by RefSeqSequence: LAVAHEKDIRVCLVEKAAQIGAHTLSGACLDPGAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMN

Additional Information

SKU 10289765
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23884