518-831-8000 sales@utechproducts.com

FAM219A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FAM219A, Each

1,148.40

Details

The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus. The function of this protein has not been determined. [provided by RefSeqSequence: MEEIDRFQVPTAHSEMQPLDPAAASISDGDCDAREGESVAMNYKPSPLQVKLEKQRELARKGSLKNGSM

Additional Information

SKU 10287429
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21199