518-831-8000 sales@utechproducts.com

FCER1G, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FCER1G, Each

1,148.40

Details

The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeqSequence: KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Additional Information

SKU 10288005
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21846