FCER1G, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FCER1G, Each
$ 1,148.40
|
|
Details:
The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeqSequence: KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Additional Information
| SKU | 10288005 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21846 |
