518-831-8000 sales@utechproducts.com

FLAD1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FLAD1, Each

1,148.40

Details:

This gene encodes the enzyme that catalyzes adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeqSequence: TNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAATKA

Additional Information

SKU 10288268
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22164