FTSJ1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FTSJ1, Each

$ 1,203.84
|
Details
The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeqSequence: FNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
Additional Information
SKU | 10292522 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB28683 |