518-831-8000 sales@utechproducts.com

FXYD6, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FXYD6, Each

1,148.40

Details:

This reference sequence was derived from multiple replicate ESTs and validated by human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD6, is novel and has not been characterized as a protein. Multiple alternatively spliced transcript variants that encode the same protein isoform have been described. RefSeq curation by Kathleen J. Sweadner, Ph.D.Sequence: SRRCKCSFNQKPRAPGDEEAQVENLITANATEP

Additional Information

SKU 10289955
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24172