518-831-8000 sales@utechproducts.com

GCET2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GCET2, Each

1,148.40

Details:

This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeqSequence: HIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFL

Additional Information

SKU 10292508
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28669