GFRA3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GFRA3, Each
$ 1,757.70
|
|
Details:
The protein encoded by this gene is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor and a member of the GDNF receptor family. It forms a signaling receptor complex with RET tyrosine kinase receptor and binds the ligand, artemin. [provided by RefSeqSequence: LPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACL
Additional Information
| SKU | 10287536 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21328 |
