GGCT Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GGCT, Each
$ 1,148.40
|
|
Details
GGCT (EC 2.3.2.4) catalyzes the formation of 5-oxoproline (pyroglutamic acid) from gamma-glutamyl dipeptides and may play a significant role in glutathione homeostasis (Oakley et al., 2008 [PubMed 18515354]).[supplied by OMIMSequence: QEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIE
Additional Information
| SKU | 10287538 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21330 |
