518-831-8000 sales@utechproducts.com

GGT7, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GGT7, Each

1,203.84

Details

This gene is a member of a gene family that encodes enzymes involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. The protein encoded by this gene consists of a heavy and a light chain, and it can interact with CT120, a plasma membrane-associated protein that is possibly involved in lung carcinogenesis. [provided by RefSeqSequence: HLVLSPPPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALASRLGDPVYDSTITESMDDMLSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTAAQVLIMGPDDFIVAMVSSLNQPFGSGLITPSGILLNS

Additional Information

SKU 10286951
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20645