GLT8D1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GLT8D1, Each
$ 1,148.40
|
|
Details
This gene encodes a member of the glycosyltransferase family. The specific function of this protein has not been determined. Three alternatively spliced variants encoding the same isoform have been described. [provided by RefSeqSequence: VPNALRHAVDGRQEEIPVVIAASEDRLGGAIAAINSIQHNTRSNVIFYIVTLNNTADHLRSWLNSDSLKSIRYKIVNFDPKLLEGKVKEDPDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQG
Additional Information
| SKU | 10286826 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20501 |
Loading Cart Data 