HDLBP Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant HDLBP, Each

$ 1,203.84
|
Details
High density lipoprotein-binding protein, also known as vigilin, is a 110kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.[supplied by OMIMSequence: DMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVE
Additional Information
SKU | 10286624 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB20269 |