518-831-8000 sales@utechproducts.com

Hdlbp Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Hdlbp, Each

1,757.70

Details:

High density lipoprotein-binding protein, also known as vigilin, is a 110kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.[supplied by OMIMSequence: DMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVE

Additional Information

SKU 10286624
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20269