518-831-8000 sales@utechproducts.com

HGSNAT, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant HGSNAT, Each

1,203.84

Details

This gene encodes a lysosomal acetyltransferase, which is one of several enzymes involved in the lysosomal degradation of heparin sulfate. Mutations in this gene are associated with Sanfilippo syndrome C, one type of the lysosomal storage disease mucopolysaccaridosis III, which results from impaired degradation of heparan sulfate. [provided by RefSeqSequence: QALLLIHNELLWTNLTVYWKSECCYHCLFQVLVNVPQSPKAGKPSAAAASVSTQHGSILQLNDTLEEKEVCRLEYRFGEFGNYSLLVKNIHNGVSEIACDLAVN

Additional Information

SKU 10288393
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22309