518-831-8000 sales@utechproducts.com

HSPA12B Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant HSPA12B, Each

1,203.84

Details

The protein encoded by this gene contains an atypical heat shock protein 70 (Hsp70) ATPase domain and is therefore a distant member of the mammalian Hsp70 family. This gene may be involved in susceptibility to atherosclerosis. [provided by RefSeqSequence: QLLDLSGRAPGGGRLGERRSIDSSFRQAREQLRRSRHSRTFLVESGVGELWAEMQAGDRYVVA

Additional Information

SKU 10286969
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20667