518-831-8000 sales@utechproducts.com

HVCN1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant HVCN1, Each

1,148.40

Details

HVCN1 is a voltage-gated proton channel highly expressed in immune tissues. Channels like HVCN1 mediate the proton conductances required by phagocytic leukocytes for the oxidative burst that underlies microbial killing (Ramsey et al., 2006 [PubMed 16554753]).[supplied by OMIMSequence: GIIISVKTRSERQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN

Additional Information

SKU 10289338
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23414