518-831-8000 sales@utechproducts.com

IL17RE Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant IL17RE, Each

1,203.84

Details

This gene encodes a protein that shares limited similarity with the interleukin-17 receptor. The function of the encoded protein has not yet been determined. Three alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported. [provided by RefSeqSequence: EKSHHISIPSPDISHKGLRSKRTQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPEVSVRLCHQWALECEELSSPYDVQKIVSGGHTVELPYEFLLPCLCMEASYLQEDTVRRKKCPFQSWPEAYGSDFWKSVHFTDYS

Additional Information

SKU 10287296
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21053